FBXO10 antibody (Middle Region)

Catalog No. ABIN632180

The Rabbit Polyclonal anti-FBXO10 antibody has been validated for WB. It is suitable to detect FBXO10 in samples from Human.

Quick Overview for FBXO10 antibody (Middle Region) (ABIN632180)

Target: FBXO10 (F-Box Protein 10 (FBXO10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBXO10 Antibody

Binding Specificity: Middle Region

Specificity: FBXO10 antibody was raised against the middle region of FBXO10

Purification: Affinity purified

Immunogen: FBXO10 antibody was raised using the middle region of FBXO10 corresponding to a region with amino acids SSSPKPGSKAGSQEAEVGSDGERVAQTPDSSDGGLSPSGEDEDEDQLMYR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO10 Blocking Peptide, (ABIN5613534), is also available for use as a blocking control in assays to test for specificity of this FBXO10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO10

Target: FBXO10 (F-Box Protein 10 (FBXO10))

Alternative Name: FBXO10

Background: Members of the F-box protein family, such as FBXO10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molecular Weight: 105 kDa (MW of target protein)