FAM217A antibody (Middle Region)

Catalog No. ABIN632181

This anti-FAM217A antibody is a Rabbit Polyclonal antibody detecting FAM217A in WB. Suitable for Human.

Quick Overview for FAM217A antibody (Middle Region) (ABIN632181)

Target: FAM217A (Family with Sequence Similarity 217, Member A (FAM217A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM217A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM217A Antibody

Binding Specificity: Middle Region

Specificity: C6 ORF146 antibody was raised against the middle region of C6 rf146

Purification: Affinity purified

Immunogen: C6 ORF146 antibody was raised using the middle region of C6 rf146 corresponding to a region with amino acids ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C6ORF146 Blocking Peptide, (ABIN938151), is also available for use as a blocking control in assays to test for specificity of this C6ORF146 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF146 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM217A

Target: FAM217A (Family with Sequence Similarity 217, Member A (FAM217A))

Alternative Name: C6ORF146

Background: The specific function of C6orf146 is not yet known.

Molecular Weight: 57 kDa (MW of target protein)