MGC48628 (N-Term) antibody

Catalog No. ABIN632193

The Rabbit Polyclonal anti-MGC48628 antibody (ABIN632193) specifically detects MGC48628 in WB. The antibody is reactive with Human samples.

Quick Overview for MGC48628 (N-Term) antibody (ABIN632193)

Target: MGC48628

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: MGC48628 antibody was raised against the N terminal of MGC48628

Purification: Affinity purified

Immunogen: MGC48628 antibody was raised using the N terminal of MGC48628 corresponding to a region with amino acids HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC48628 Blocking Peptide, (ABIN939132), is also available for use as a blocking control in assays to test for specificity of this MGC48628 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC48628 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: MGC48628

Background: The function of MGC48628 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 74 kDa (MW of target protein)