VIPAR antibody (Middle Region)

Catalog No. ABIN632204

Product Details anti-VIPAR Antibody

Target: VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VIPAR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VIPAR antibody was raised against the middle region of VIPAR

Purification: Affinity purified

Immunogen: VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VIPAR Blocking Peptide, catalog no. 33R-9490, is also available for use as a blocking control in assays to test for specificity of this VIPAR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIPAR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VIPAR

Target: VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))

Alternative Name: VIPAR (VIPAR Products)

Synonyms: C8H14orf133 antibody, VIPAR antibody, VPS16 antibody, VPS16A antibody, spe39 antibody, spe-39 antibody, vps16b antibody, MGC85203 antibody, c14orf133 antibody, C14orf133 antibody, SPE-39 antibody, SPE39 antibody, VPS16B antibody, hSPE-39 antibody, 6720456H09Rik antibody, 9330175H22Rik antibody, AI413782 antibody, Spe39 antibody, Vipar antibody, si:ch211-20b12.1 antibody, vipar antibody, wu:fb63f10 antibody, C10H14orf133 antibody, VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog antibody, VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog L homeolog antibody, VIPAS39 antibody, vipas39.L antibody, vipas39 antibody, Vipas39 antibody

Background: This protein is involved in the sorting of lysosomal proteins. Mutations in this gene are associated with ARCS2 (arthrogryposis, renal dysfunction, and cholestasis-2). Alternative splicing results in multiple transcript variants.

Molecular Weight: 57 kDa (MW of target protein)