C11orf65 antibody (N-Term)
-
- Target See all C11orf65 products
- C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))
- Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C11orf65 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C11 ORF65 antibody was raised against the N terminal Of C11 rf65
- Purification
- Affinity purified
- Immunogen
- C11 ORF65 antibody was raised using the N terminal Of C11 rf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C11ORF65 Blocking Peptide, catalog no. 33R-6312, is also available for use as a blocking control in assays to test for specificity of this C11ORF65 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))
- Alternative Name
- C11ORF65 (C11orf65 Products)
- Background
- The specific function of C11orf65 is not yet known.
- Molecular Weight
- 37 kDa (MW of target protein)
-