C11orf65 antibody (N-Term)

Catalog No. ABIN632207

The Rabbit Polyclonal anti-C11orf65 antibody has been validated for WB. It is suitable to detect C11orf65 in samples from Human, Mouse and Rat.

Quick Overview for C11orf65 antibody (N-Term) (ABIN632207)

Target: C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C11orf65 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C11orf65 Antibody

Binding Specificity: N-Term

Specificity: C11 ORF65 antibody was raised against the N terminal Of C11 rf65

Purification: Affinity purified

Immunogen: C11 ORF65 antibody was raised using the N terminal Of C11 rf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C11ORF65 Blocking Peptide, (ABIN5612393), is also available for use as a blocking control in assays to test for specificity of this C11ORF65 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C11orf65

Target: C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))

Alternative Name: C11ORF65

Background: The specific function of C11orf65 is not yet known.

Molecular Weight: 37 kDa (MW of target protein)