HAGH antibody (C-Term)

Catalog No. ABIN632208

This anti-HAGH antibody is a Rabbit Polyclonal antibody detecting HAGH in WB. Suitable for Human.

Quick Overview for HAGH antibody (C-Term) (ABIN632208)

Target: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAGH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HAGH Antibody

Binding Specificity: C-Term

Specificity: HAGH antibody was raised against the C terminal of HAGH

Purification: Affinity purified

Immunogen: HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAGH Blocking Peptide, (ABIN938233), is also available for use as a blocking control in assays to test for specificity of this HAGH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAGH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAGH

Target: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Alternative Name: HAGH

Background: HAGH is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

Molecular Weight: 29 kDa (MW of target protein)