Glutaredoxin 1 antibody

Catalog No. ABIN632220

Product Details anti-Glutaredoxin 1 Antibody

Target: Glutaredoxin 1 (GRX1)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glutaredoxin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GLRX antibody was raised using a synthetic peptide corresponding to a region with amino acids IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLRX Blocking Peptide, catalog no. 33R-4029, is also available for use as a blocking control in assays to test for specificity of this GLRX antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glutaredoxin 1

Target: Glutaredoxin 1 (GRX1)

Alternative Name: GLRX (GRX1 Products)

Target Type: Viral Protein

Background: GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.

Molecular Weight: 12 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis