ETF1 antibody (N-Term)

Catalog No. ABIN632229

Product Details anti-ETF1 Antibody

Target: ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ETF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ETF1 antibody was raised against the N terminal of ETF1

Purification: Affinity purified

Immunogen: ETF1 antibody was raised using the N terminal of ETF1 corresponding to a region with amino acids ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ETF1 Blocking Peptide, catalog no. 33R-4157, is also available for use as a blocking control in assays to test for specificity of this ETF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ETF1

Target: ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))

Alternative Name: ETF1 (ETF1 Products)

Background: Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP.

Molecular Weight: 49 kDa (MW of target protein)