Casein Kinase 1 gamma 2 antibody (Middle Region)

Catalog No. ABIN632231

The Rabbit Polyclonal anti-Casein Kinase 1 gamma 2 antibody has been validated for WB. It is suitable to detect Casein Kinase 1 gamma 2 in samples from Human.

Quick Overview for Casein Kinase 1 gamma 2 antibody (Middle Region) (ABIN632231)

Target: Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Casein Kinase 1 gamma 2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Casein Kinase 1 gamma 2 Antibody

Binding Specificity: Middle Region

Specificity: CK1 gamma 2 antibody was raised against the middle region of CSNK1 G2

Purification: Affinity purified

Immunogen: CK1 gamma 2 antibody was raised using the middle region of CSNK1 G2 corresponding to a region with amino acids SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CK1 gamma 2 Blocking Peptide, (ABIN5612899), is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Casein Kinase 1 gamma 2

Target: Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))

Background: CSNK1G2 belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family, casein kinase I subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt signaling.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Hedgehog Signaling