Casein Kinase 1 gamma 2 antibody (Middle Region)
-
- Target See all Casein Kinase 1 gamma 2 (CSNK1G2) Antibodies
- Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Casein Kinase 1 gamma 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CK1 gamma 2 antibody was raised against the middle region of CSNK1 G2
- Purification
- Affinity purified
- Immunogen
- CK1 gamma 2 antibody was raised using the middle region of CSNK1 G2 corresponding to a region with amino acids SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR
- Top Product
- Discover our top product CSNK1G2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CK1 gamma 2 Blocking Peptide, catalog no. 33R-8561, is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Casein Kinase 1 gamma 2 (CSNK1G2) (Casein Kinase 1, gamma 2 (CSNK1G2))
- Abstract
- CSNK1G2 Products
- Background
- CSNK1G2 belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family, casein kinase I subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt signaling.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- Hedgehog Signaling
-