IFI44 antibody (Middle Region)

Catalog No. ABIN632234

The Rabbit Polyclonal anti-IFI44 antibody has been validated for WB. It is suitable to detect IFI44 in samples from Human.

Quick Overview for IFI44 antibody (Middle Region) (ABIN632234)

Target: IFI44 (Interferon-Induced Protein 44 (IFI44))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFI44 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IFI44 Antibody

Binding Specificity: Middle Region

Specificity: IFI44 antibody was raised against the middle region of IFI44

Purification: Affinity purified

Immunogen: IFI44 antibody was raised using the middle region of IFI44 corresponding to a region with amino acids LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFI44 Blocking Peptide, (ABIN940428), is also available for use as a blocking control in assays to test for specificity of this IFI44 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI44 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFI44

Target: IFI44 (Interferon-Induced Protein 44 (IFI44))

Alternative Name: IFI44

Background: This protein aggregates to form microtubular structures.

Molecular Weight: 50 kDa (MW of target protein)