FAM45B antibody (Middle Region)

Catalog No. ABIN632236

This Rabbit Polyclonal antibody specifically detects FAM45B in WB. It exhibits reactivity toward Human.

Quick Overview for FAM45B antibody (Middle Region) (ABIN632236)

Target: FAM45B (Family with Sequence Similarity 45, Member B (Pseudogene) (FAM45B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM45B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM45B Antibody

Binding Specificity: Middle Region

Specificity: FAM45 B antibody was raised against the middle region of FAM45

Purification: Affinity purified

Immunogen: FAM45 B antibody was raised using the middle region of FAM45 corresponding to a region with amino acids FLSKDFDARKAYPAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM45B Blocking Peptide, (ABIN938374), is also available for use as a blocking control in assays to test for specificity of this FAM45B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM45B

Target: FAM45B (Family with Sequence Similarity 45, Member B (Pseudogene) (FAM45B))

Alternative Name: FAM45B

Background: The function of FAM45 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 40 kDa (MW of target protein)