TBCB antibody (C-Term)

Catalog No. ABIN632246

The Rabbit Polyclonal anti-TBCB antibody has been validated for WB. It is suitable to detect TBCB in samples from Human, Mouse and Rat.

Quick Overview for TBCB antibody (C-Term) (ABIN632246)

Target: TBCB (Tubulin Folding Cofactor B (TBCB))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBCB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TBCB Antibody

Binding Specificity: C-Term

Specificity: TBCB antibody was raised against the C terminal of TBCB

Purification: Affinity purified

Immunogen: TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBCB Blocking Peptide, (ABIN936023), is also available for use as a blocking control in assays to test for specificity of this TBCB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBCB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBCB

Target: TBCB (Tubulin Folding Cofactor B (TBCB))

Alternative Name: TBCB

Background: TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.

Molecular Weight: 27 kDa (MW of target protein)