FUNDC1 antibody (N-Term)

Catalog No. ABIN632253

This anti-FUNDC1 antibody is a Rabbit Polyclonal antibody detecting FUNDC1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for FUNDC1 antibody (N-Term) (ABIN632253)

Target: FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FUNDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FUNDC1 Antibody

Binding Specificity: N-Term

Specificity: FUNDC1 antibody was raised against the N terminal of FUNDC1

Purification: Affinity purified

Immunogen: FUNDC1 antibody was raised using the N terminal of FUNDC1 corresponding to a region with amino acids MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FUNDC1 Blocking Peptide, catalog no. 33R-5789, is also available for use as a blocking control in assays to test for specificity of this FUNDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUNDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FUNDC1

Target: FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))

Alternative Name: FUNDC1

Background: FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.

Molecular Weight: 17 kDa (MW of target protein)