PEX7 antibody (N-Term)

Catalog No. ABIN632262

This anti-PEX7 antibody is a Rabbit Polyclonal antibody detecting PEX7 in WB. Suitable for Mouse and Human.

Quick Overview for PEX7 antibody (N-Term) (ABIN632262)

Target: PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))

Reactivity: Mouse, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEX7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PEX7 Antibody

Binding Specificity: N-Term

Specificity: PEX7 antibody was raised against the N terminal of PEX7

Purification: Affinity purified

Immunogen: PEX7 antibody was raised using the N terminal of PEX7 corresponding to a region with amino acids MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEX7 Blocking Peptide, (ABIN5615320), is also available for use as a blocking control in assays to test for specificity of this PEX7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEX7

Target: PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))

Alternative Name: PEX7

Background: PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process