PEX7 antibody (N-Term)
-
- Target See all PEX7 Antibodies
- PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PEX7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PEX7 antibody was raised against the N terminal of PEX7
- Purification
- Affinity purified
- Immunogen
- PEX7 antibody was raised using the N terminal of PEX7 corresponding to a region with amino acids MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI
- Top Product
- Discover our top product PEX7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PEX7 Blocking Peptide, catalog no. 33R-6402, is also available for use as a blocking control in assays to test for specificity of this PEX7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))
- Alternative Name
- PEX7 (PEX7 Products)
- Synonyms
- PEX7 antibody, pex7 antibody, DDBDRAFT_0206295 antibody, DDBDRAFT_0233068 antibody, DDB_0206295 antibody, DDB_0233068 antibody, MmPEX7 antibody, PBD9B antibody, PTS2R antibody, RCDP1 antibody, RD antibody, zgc:103552 antibody, Peroxin-7 antibody, peroxisomal biogenesis factor 7 antibody, WD40 repeat-containing protein antibody, PEX7 antibody, pex7 antibody, Pex7 antibody
- Background
- PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-