CAB39 antibody (Middle Region)

Catalog No. ABIN632269

This Rabbit Polyclonal antibody specifically detects CAB39 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CAB39 antibody (Middle Region) (ABIN632269)

Target: CAB39 (Calcium Binding Protein 39 (CAB39))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CAB39 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CAB39 Antibody

Binding Specificity: Middle Region

Specificity: CAB39 antibody was raised against the middle region of CAB39

Purification: Affinity purified

Immunogen: CAB39 antibody was raised using the middle region of CAB39 corresponding to a region with amino acids KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAB39 Blocking Peptide, (ABIN940074), is also available for use as a blocking control in assays to test for specificity of this CAB39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAB39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CAB39

Target: CAB39 (Calcium Binding Protein 39 (CAB39))

Alternative Name: CAB39

Background: Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: AMPK Signaling