Allantoicase antibody (N-Term)

Catalog No. ABIN632271

This anti-Allantoicase antibody is a Rabbit Polyclonal antibody detecting Allantoicase in WB. Suitable for Human.

Quick Overview for Allantoicase antibody (N-Term) (ABIN632271)

Target: Allantoicase (ALLC)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Allantoicase antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Allantoicase Antibody

Binding Specificity: N-Term

Specificity: ALLC antibody was raised against the N terminal of ALLC

Purification: Affinity purified

Immunogen: ALLC antibody was raised using the N terminal of ALLC corresponding to a region with amino acids VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALLC Blocking Peptide, (ABIN5612027), is also available for use as a blocking control in assays to test for specificity of this ALLC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALLC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Allantoicase

Target: Allantoicase (ALLC)

Alternative Name: ALLC

Background: Allantoicase participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase, was lost during vertebrate evolution.

Molecular Weight: 43 kDa (MW of target protein)