PPME1 antibody (N-Term)

Catalog No. ABIN632281

This Rabbit Polyclonal antibody specifically detects PPME1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PPME1 antibody (N-Term) (ABIN632281)

Target: PPME1 (Protein Phosphatase Methylesterase 1 (PPME1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPME1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPME1 Antibody

Binding Specificity: N-Term

Specificity: PPME1 antibody was raised against the N terminal of PPME1

Purification: Affinity purified

Immunogen: PPME1 antibody was raised using the N terminal of PPME1 corresponding to a region with amino acids MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPME1 Blocking Peptide, (ABIN5615502), is also available for use as a blocking control in assays to test for specificity of this PPME1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPME1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPME1

Target: PPME1 (Protein Phosphatase Methylesterase 1 (PPME1))

Alternative Name: PPME1

Background: Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process