ARL11 antibody (Middle Region)

Catalog No. ABIN632291

The Rabbit Polyclonal anti-ARL11 antibody has been validated for WB. It is suitable to detect ARL11 in samples from Human, Rat and Mouse.

Quick Overview for ARL11 antibody (Middle Region) (ABIN632291)

Target: ARL11 (ADP-Ribosylation Factor-Like 11 (ARL11))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARL11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ARL11 Antibody

Binding Specificity: Middle Region

Specificity: ARL11 antibody was raised against the middle region of ARL11

Purification: Affinity purified

Immunogen: ARL11 antibody was raised using the middle region of ARL11 corresponding to a region with amino acids WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARL11 Blocking Peptide, (ABIN5612157), is also available for use as a blocking control in assays to test for specificity of this ARL11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARL11

Target: ARL11 (ADP-Ribosylation Factor-Like 11 (ARL11))

Alternative Name: ARL11

Background: ARL11 belongs to the small GTPase superfamily, Arf family. It may play a role in apoptosis and act as a tumor suppressor. Defects in ARL11 may be a cause of susceptibility to chronic lymphocytic leukemia (CLL).

Molecular Weight: 21 kDa (MW of target protein)