TRABD antibody (Middle Region)

Catalog No. ABIN632292

The Rabbit Polyclonal anti-TRABD antibody (ABIN632292) specifically detects TRABD in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for TRABD antibody (Middle Region) (ABIN632292)

Target: TRABD (TraB Domain Containing (TRABD))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRABD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRABD Antibody

Binding Specificity: Middle Region

Specificity: TRABD antibody was raised against the middle region of TRABD

Purification: Affinity purified

Immunogen: TRABD antibody was raised using the middle region of TRABD corresponding to a region with amino acids LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRABD Blocking Peptide, (ABIN940204), is also available for use as a blocking control in assays to test for specificity of this TRABD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRABD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRABD

Target: TRABD (TraB Domain Containing (TRABD))

Alternative Name: TRABD

Background: The function of TRABD protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 42 kDa (MW of target protein)