Esterase D antibody (N-Term)

Catalog No. ABIN632304

This anti-Esterase D antibody is a Rabbit Polyclonal antibody detecting Esterase D in WB. Suitable for Human.

Quick Overview for Esterase D antibody (N-Term) (ABIN632304)

Target: Esterase D (ESD)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Esterase D antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Esterase D Antibody

Binding Specificity: N-Term

Specificity: ESD antibody was raised against the N terminal of ESD

Purification: Affinity purified

Immunogen: ESD antibody was raised using the N terminal of ESD corresponding to a region with amino acids MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ESD Blocking Peptide, (ABIN5613402), is also available for use as a blocking control in assays to test for specificity of this ESD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Esterase D

Target: Esterase D (ESD)

Alternative Name: ESD

Background: ESD is a serine hydrolase involved in the detoxification of formaldehyde.

Molecular Weight: 31 kDa (MW of target protein)