SUN3 antibody (C-Term)
-
- Target See all SUN3 Antibodies
- SUN3 (Sad1 and UNC84 Domain Containing 3 (SUN3))
- Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SUN3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SUNC1 antibody was raised against the C terminal of SUNC1
- Purification
- Affinity purified
- Immunogen
- SUNC1 antibody was raised using the C terminal of SUNC1 corresponding to a region with amino acids IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SUNC1 Blocking Peptide, catalog no. 33R-4024, is also available for use as a blocking control in assays to test for specificity of this SUNC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUNC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SUN3 (Sad1 and UNC84 Domain Containing 3 (SUN3))
- Alternative Name
- SUNC1 (SUN3 Products)
- Background
- SUNC1 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.
- Molecular Weight
- 40 kDa (MW of target protein)
-