Syntrophin gamma 1 antibody (Middle Region)

Catalog No. ABIN632306

The Rabbit Polyclonal anti-Syntrophin gamma 1 antibody has been validated for WB. It is suitable to detect Syntrophin gamma 1 in samples from Human.

Quick Overview for Syntrophin gamma 1 antibody (Middle Region) (ABIN632306)

Target: Syntrophin gamma 1 (SNTG1) (Syntrophin, gamma 1 (SNTG1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Syntrophin gamma 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Syntrophin gamma 1 Antibody

Binding Specificity: Middle Region

Specificity: Syntrophin Gamma 1 antibody was raised against the middle region of SNTG1

Purification: Affinity purified

Immunogen: Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Syntrophin Gamma 1 Blocking Peptide, (ABIN5616483), is also available for use as a blocking control in assays to test for specificity of this Syntrophin Gamma 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNTG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Syntrophin gamma 1

Target: Syntrophin gamma 1 (SNTG1) (Syntrophin, gamma 1 (SNTG1))

Alternative Name: Syntrophin gamma 1

Background: The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins.

Molecular Weight: 58 kDa (MW of target protein)