Syntrophin gamma 1 antibody (Syntrophin, gamma 1) (Middle Region)

Details for Product anti-SNTG1 Antibody No. ABIN632306, Supplier: Log in to see
Antigen
  • SNTG1
  • G1SYN
  • SYN4
  • 4933426D16Rik
  • RGD1560290
  • syntrophin gamma 1
  • gamma-1-syntrophin
  • syntrophin, gamma 1
  • SNTG1
  • sntg1
  • LOC100548083
  • Sntg1
Epitope
Middle Region
12
3
1
1
1
1
Reactivity
Human
25
6
4
4
3
3
2
2
2
1
1
Host
Rabbit
14
8
5
Clonality
Polyclonal
Conjugate
This Syntrophin gamma 1 antibody is un-conjugated
1
1
1
1
1
1
Application
Western Blotting (WB)
13
13
6
3
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS
Specificity Syntrophin Gamma 1 antibody was raised against the middle region of SNTG1
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others Syntrophin gamma 1 products on genomics-online (e.g. as negative or positive controls)
Alternative Name Syntrophin gamma 1 (SNTG1 Antibody Abstract)
Background The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins.
Molecular Weight 58 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

Syntrophin Gamma 1 Blocking Peptide, catalog no. 33R-7908, is also available for use as a blocking control in assays to test for specificity of this Syntrophin Gamma 1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNTG1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Western Blotting (WB) image for anti-Syntrophin, gamma 1 (SNTG1) (Middle Region) antibody (ABIN632306) Syntrophin Gamma 1 antibody used at 1 ug/ml to detect target protein.
Did you look for something else?