Cyclin J antibody (N-Term)

Catalog No. ABIN632310

This anti-Cyclin J antibody is a Rabbit Polyclonal antibody detecting Cyclin J in WB. Suitable for Human.

Quick Overview for Cyclin J antibody (N-Term) (ABIN632310)

Target: Cyclin J (CCNJ)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cyclin J antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cyclin J Antibody

Binding Specificity: N-Term

Specificity: Cyclin J antibody was raised against the N terminal of CCNJ

Purification: Affinity purified

Immunogen: Cyclin J antibody was raised using the N terminal of CCNJ corresponding to a region with amino acids FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cyclin J Blocking Peptide, (ABIN938382), is also available for use as a blocking control in assays to test for specificity of this Cyclin J antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNJ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cyclin J

Target: Cyclin J (CCNJ)

Alternative Name: Cyclin J

Background: Cyclin J may be involved in cell division and differentiation.

Molecular Weight: 42 kDa (MW of target protein)