KLHDC2 antibody (N-Term)

Catalog No. ABIN632311

This Rabbit Polyclonal antibody specifically detects KLHDC2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for KLHDC2 antibody (N-Term) (ABIN632311)

Target: KLHDC2 (Kelch Domain Containing 2 (KLHDC2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHDC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KLHDC2 Antibody

Binding Specificity: N-Term

Specificity: KLHDC2 antibody was raised against the N terminal of KLHDC2

Purification: Affinity purified

Immunogen: KLHDC2 antibody was raised using the N terminal of KLHDC2 corresponding to a region with amino acids VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHDC2 Blocking Peptide, (ABIN5614369), is also available for use as a blocking control in assays to test for specificity of this KLHDC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHDC2

Target: KLHDC2 (Kelch Domain Containing 2 (KLHDC2))

Alternative Name: KLHDC2

Background: KLHDC2 represses CREB3-mediated transcription by interfering with CREB3-DNA binding. It contains 6 Kelch repeats.

Molecular Weight: 46 kDa (MW of target protein)