EXOC6 antibody (N-Term)

Catalog No. ABIN632342

The Rabbit Polyclonal anti-EXOC6 antibody has been validated for WB. It is suitable to detect EXOC6 in samples from Human.

Quick Overview for EXOC6 antibody (N-Term) (ABIN632342)

Target: EXOC6 (Exocyst Complex Component 6 (EXOC6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOC6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EXOC6 Antibody

Binding Specificity: N-Term

Specificity: EXOC6 antibody was raised against the N terminal of EXOC6

Purification: Affinity purified

Immunogen: EXOC6 antibody was raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOC6 Blocking Peptide, (ABIN5613429), is also available for use as a blocking control in assays to test for specificity of this EXOC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOC6

Target: EXOC6 (Exocyst Complex Component 6 (EXOC6))

Alternative Name: EXOC6

Background: The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molecular Weight: 88 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis