Exocyst Complex Component 6 (EXOC6) (N-Term) antibody

Details for Product No. ABIN632342
Antigen
Epitope
N-Term
2
2
1
Reactivity
Human
10
7
6
4
4
4
4
3
2
2
2
2
1
1
Host
Rabbit
10
Clonality
Polyclonal
Application
Western Blotting (WB)
10
4
1
1
Options
Immunogen EXOC6 antibody was raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI
Specificity EXOC6 antibody was raised against the N terminal of EXOC6
Purification Affinity purified
Antigen
Alternative Name EXOC6 (EXOC6 Antibody Abstract)
Background The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight 88 kDa (MW of target protein)
Pathways Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

EXOC6 Blocking Peptide, catalog no. 33R-6184, is also available for use as a blocking control in assays to test for specificity of this EXOC6 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC6 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Exocyst Complex Component 6 (EXOC6) (N-Term) antibody (ABIN632342) EXOC6 antibody used at 1 ug/ml to detect target protein.