RWDD2A antibody (N-Term)

Catalog No. ABIN632350

This Rabbit Polyclonal antibody specifically detects RWDD2A in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for RWDD2A antibody (N-Term) (ABIN632350)

Target: RWDD2A (RWD Domain Containing 2A (RWDD2A))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RWDD2A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RWDD2A Antibody

Binding Specificity: N-Term

Specificity: RWDD2 A antibody was raised against the N terminal of RWDD2

Purification: Affinity purified

Immunogen: RWDD2 A antibody was raised using the N terminal of RWDD2 corresponding to a region with amino acids NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RWDD2A Blocking Peptide, (ABIN5615979), is also available for use as a blocking control in assays to test for specificity of this RWDD2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RWDD2A

Target: RWDD2A (RWD Domain Containing 2A (RWDD2A))

Alternative Name: RWDD2A

Background: The specific function of RWDD2A is not yet known.

Molecular Weight: 32 kDa (MW of target protein)