FBXL14 antibody (N-Term)

Catalog No. ABIN632352

The Rabbit Polyclonal anti-FBXL14 antibody (ABIN632352) specifically detects FBXL14 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for FBXL14 antibody (N-Term) (ABIN632352)

Target: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXL14 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBXL14 Antibody

Binding Specificity: N-Term

Specificity: FBXL14 antibody was raised against the N terminal of FBXL14

Purification: Affinity purified

Immunogen: FBXL14 antibody was raised using the N terminal of FBXL14 corresponding to a region with amino acids WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXL14 Blocking Peptide, (ABIN5613528), is also available for use as a blocking control in assays to test for specificity of this FBXL14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXL14

Target: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Alternative Name: FBXL14

Background: FBXL14 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL14, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.

Molecular Weight: 46 kDa (MW of target protein)