FAM76A antibody (Middle Region)

Catalog No. ABIN632353

This Rabbit Polyclonal antibody specifically detects FAM76A in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for FAM76A antibody (Middle Region) (ABIN632353)

Target: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM76A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM76A Antibody

Binding Specificity: Middle Region

Specificity: FAM76 A antibody was raised against the middle region of FAM76

Purification: Affinity purified

Immunogen: FAM76 A antibody was raised using the middle region of FAM76 corresponding to a region with amino acids QCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM76A Blocking Peptide, (ABIN5613501), is also available for use as a blocking control in assays to test for specificity of this FAM76A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM76A

Target: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Alternative Name: FAM76A

Background: The specific function of FAM76A is not yet known.

Molecular Weight: 35 kDa (MW of target protein)