FBXO16 antibody (C-Term)

Catalog No. ABIN632356

This Rabbit Polyclonal antibody specifically detects FBXO16 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for FBXO16 antibody (C-Term) (ABIN632356)

Target: FBXO16 (F-Box Protein 16 (FBXO16))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO16 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBXO16 Antibody

Binding Specificity: C-Term

Specificity: FBXO16 antibody was raised against the C terminal of FBXO16

Purification: Affinity purified

Immunogen: FBXO16 antibody was raised using the C terminal of FBXO16 corresponding to a region with amino acids SPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO16 Blocking Peptide, (ABIN5613536), is also available for use as a blocking control in assays to test for specificity of this FBXO16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO16

Target: FBXO16 (F-Box Protein 16 (FBXO16))

Alternative Name: FBXO16

Background: FBXO16 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO16 belongs to the Fbx class.

Molecular Weight: 34 kDa (MW of target protein)