KLK-BL4 (C-Term) antibody

Catalog No. ABIN632362

This Rabbit Polyclonal antibody specifically detects in WB. It exhibits reactivity toward Human.

Quick Overview for KLK-BL4 (C-Term) antibody (ABIN632362)

Target: KLK-BL4

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details

Binding Specificity: C-Term

Specificity: KLK-BL4 antibody was raised against the C terminal Of Klkbl4

Purification: Affinity purified

Immunogen: KLK-BL4 antibody was raised using the C terminal Of Klkbl4 corresponding to a region with amino acids EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLK-BL4 Blocking Peptide, (ABIN937670), is also available for use as a blocking control in assays to test for specificity of this KLK-BL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLKBL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: KLK-BL4

Background: Klkbl4 is a secreted protein. Klkbl4 belongs to the peptidase S1 family, plasma kallikrein subfamily. It contains 1 peptidase S1 domain.

Molecular Weight: 44 kDa (MW of target protein)