Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) (N-Term) antibody
-
- Target See all Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) Antibodies
- Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRRC51 antibody was raised against the N terminal of LRRC51
- Purification
- Affinity purified
- Immunogen
- LRRC51 antibody was raised using the N terminal of LRRC51 corresponding to a region with amino acids MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL
- Top Product
- Discover our top product LRTOMT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRRC51 Blocking Peptide, catalog no. 33R-6248, is also available for use as a blocking control in assays to test for specificity of this LRRC51 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC51 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)
- Alternative Name
- LRRC51 (LRTOMT Products)
- Background
- LRRC51 encodes two different proteins. One is a leucine-rich transmembrane protein of unknown function while the other is an O-methyltransferase. Defects in the O-methyltransferase protein can cause nonsyndromic deafness. Several transcript variants encoding different isoforms of each protein have been found for this gene, along with a transcript that is not thought to be protein-coding.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-