Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) (N-Term) antibody

Catalog No. ABIN632367

This anti-not_set antibody is a Rabbit Polyclonal antibody detecting not_set in WB. Suitable for Human.

Quick Overview for Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) (N-Term) antibody (ABIN632367)

Target: Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: LRRC51 antibody was raised against the N terminal of LRRC51

Purification: Affinity purified

Immunogen: LRRC51 antibody was raised using the N terminal of LRRC51 corresponding to a region with amino acids MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC51 Blocking Peptide, (ABIN5614579), is also available for use as a blocking control in assays to test for specificity of this LRRC51 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC51 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)

Alternative Name: LRRC51

Background: LRRC51 encodes two different proteins. One is a leucine-rich transmembrane protein of unknown function while the other is an O-methyltransferase. Defects in the O-methyltransferase protein can cause nonsyndromic deafness. Several transcript variants encoding different isoforms of each protein have been found for this gene, along with a transcript that is not thought to be protein-coding.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Sensory Perception of Sound