RIMKLA antibody (Middle Region)

Catalog No. ABIN632370

The Rabbit Polyclonal anti-RIMKLA antibody (ABIN632370) specifically detects RIMKLA in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for RIMKLA antibody (Middle Region) (ABIN632370)

Target: RIMKLA (Ribosomal Modification Protein RimK-Like Family Member A (RIMKLA))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RIMKLA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RIMKLA Antibody

Binding Specificity: Middle Region

Specificity: FAM80 A antibody was raised against the middle region of FAM80

Purification: Affinity purified

Immunogen: FAM80 A antibody was raised using the middle region of FAM80 corresponding to a region with amino acids EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM80A Blocking Peptide, (ABIN937641), is also available for use as a blocking control in assays to test for specificity of this FAM80A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RIMKLA

Target: RIMKLA (Ribosomal Modification Protein RimK-Like Family Member A (RIMKLA))

Alternative Name: FAM80A

Background: The specific function of FAM80A is not yet known.

Molecular Weight: 38 kDa (MW of target protein)