PFKFB4 antibody (N-Term)

Catalog No. ABIN632373

This anti-PFKFB4 antibody is a Rabbit Polyclonal antibody detecting PFKFB4 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for PFKFB4 antibody (N-Term) (ABIN632373)

Target: PFKFB4 (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PFKFB4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PFKFB4 Antibody

Binding Specificity: N-Term

Specificity: PFKFB4 antibody was raised against the N terminal of PFKFB4

Purification: Affinity purified

Immunogen: PFKFB4 antibody was raised using the N terminal of PFKFB4 corresponding to a region with amino acids MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PFKFB4 Blocking Peptide, (ABIN5615325), is also available for use as a blocking control in assays to test for specificity of this PFKFB4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKFB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PFKFB4

Target: PFKFB4 (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4))

Alternative Name: PFKFB4

Background: PFKFB4 synthesis and degradation of fructose 2,6-bisphosphate.

Molecular Weight: 54 kDa (MW of target protein)