HAUS7 antibody (Middle Region)

Catalog No. ABIN632374

This Rabbit Polyclonal antibody specifically detects HAUS7 in WB. It exhibits reactivity toward Human.

Quick Overview for HAUS7 antibody (Middle Region) (ABIN632374)

Target: HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAUS7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HAUS7 Antibody

Binding Specificity: Middle Region

Specificity: UCHL5 IP antibody was raised against the middle region of UCHL5 P

Purification: Affinity purified

Immunogen: UCHL5 IP antibody was raised using the middle region of UCHL5 P corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UCHL5IP Blocking Peptide, (ABIN940511), is also available for use as a blocking control in assays to test for specificity of this UCHL5IP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAUS7

Target: HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))

Alternative Name: UCHL5IP

Background: This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom

Molecular Weight: 47 kDa (MW of target protein)