ARL17 antibody (Middle Region)
-
- Target See all ARL17 Antibodies
- ARL17 (ADP-Ribosylation Factor-Like 17B (ARL17))
- Binding Specificity
- Middle Region
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ARL17 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- ARL17 antibody was raised against the middle region of ARL17
- Purification
- Affinity purified
- Immunogen
- ARL17 antibody was raised using the middle region of ARL17 corresponding to a region with amino acids KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD
- Top Product
- Discover our top product ARL17 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ARL17 Blocking Peptide, catalog no. 33R-4276, is also available for use as a blocking control in assays to test for specificity of this ARL17 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL17 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARL17 (ADP-Ribosylation Factor-Like 17B (ARL17))
- Alternative Name
- ARL17 (ARL17 Products)
- Synonyms
- ARL17 antibody, ARL17A antibody, ADP ribosylation factor like GTPase 17B antibody, ARL17B antibody
- Background
- ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus.
- Molecular Weight
- 19 kDa (MW of target protein)
-