Amphiphysin antibody (N-Term)
-
- Target See all Amphiphysin (AMPH) Antibodies
- Amphiphysin (AMPH)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Amphiphysin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Amphiphysin antibody was raised against the N terminal of AMPH
- Purification
- Affinity purified
- Immunogen
- Amphiphysin antibody was raised using the N terminal of AMPH corresponding to a region with amino acids ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA
- Top Product
- Discover our top product AMPH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Amphiphysin Blocking Peptide, catalog no. 33R-1095, is also available for use as a blocking control in assays to test for specificity of this Amphiphysin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMPH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Amphiphysin (AMPH)
- Alternative Name
- Amphiphysin (AMPH Products)
- Background
- AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.
- Molecular Weight
- 76 kDa (MW of target protein)
-