gamma 1 Adaptin antibody (C-Term)

Catalog No. ABIN632398

Product Details anti-gamma 1 Adaptin Antibody

Target: gamma 1 Adaptin (AP1G1) (Adaptor-Related Protein Complex 1, gamma 1 Subunit (AP1G1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This gamma 1 Adaptin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AP1 G1 antibody was raised against the C terminal of AP1 1

Purification: Affinity purified

Immunogen: AP1 G1 antibody was raised using the C terminal of AP1 1 corresponding to a region with amino acids DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AP1G1 Blocking Peptide, catalog no. 33R-1979, is also available for use as a blocking control in assays to test for specificity of this AP1G1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for gamma 1 Adaptin

Target: gamma 1 Adaptin (AP1G1) (Adaptor-Related Protein Complex 1, gamma 1 Subunit (AP1G1))

Alternative Name: AP1G1 (AP1G1 Products)

Background: Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.

Molecular Weight: 91 kDa (MW of target protein)