TTC23L antibody (N-Term)

Catalog No. ABIN632401

This Rabbit Polyclonal antibody specifically detects TTC23L in WB. It exhibits reactivity toward Human.

Quick Overview for TTC23L antibody (N-Term) (ABIN632401)

Target: TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TTC23L antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TTC23L Antibody

Binding Specificity: N-Term

Specificity: FLJ25439 antibody was raised against the N terminal Of Flj25439

Purification: Affinity purified

Immunogen: FLJ25439 antibody was raised using the N terminal Of Flj25439 corresponding to a region with amino acids MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ25439 Blocking Peptide, (ABIN5613609), is also available for use as a blocking control in assays to test for specificity of this FLJ25439 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ25439 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TTC23L

Target: TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))

Background: The function of FLJ25439 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 41 kDa (MW of target protein)