TMED8 antibody (Middle Region)

Catalog No. ABIN632407

This Rabbit Polyclonal antibody specifically detects TMED8 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TMED8 antibody (Middle Region) (ABIN632407)

Target: TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMED8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMED8 Antibody

Binding Specificity: Middle Region

Specificity: TMED8 antibody was raised against the middle region of TMED8

Purification: Affinity purified

Immunogen: TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMED8 Blocking Peptide, (ABIN937852), is also available for use as a blocking control in assays to test for specificity of this TMED8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMED8

Target: TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))

Alternative Name: TMED8

Background: The function of TMED8 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 36 kDa (MW of target protein)