SH3GL1 antibody (N-Term)

Catalog No. ABIN632409

This anti-SH3GL1 antibody is a Rabbit Polyclonal antibody detecting SH3GL1 in WB. Suitable for Human, Rat and Mouse.

Quick Overview for SH3GL1 antibody (N-Term) (ABIN632409)

Target: SH3GL1 (SH3-Domain GRB2-Like 1 (SH3GL1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH3GL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SH3GL1 Antibody

Binding Specificity: N-Term

Specificity: SH3 GL1 antibody was raised against the N terminal of SH3 L1

Purification: Affinity purified

Immunogen: SH3 GL1 antibody was raised using the N terminal of SH3 L1 corresponding to a region with amino acids LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH3GL1 Blocking Peptide, (ABIN5616126), is also available for use as a blocking control in assays to test for specificity of this SH3GL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH3GL1

Target: SH3GL1 (SH3-Domain GRB2-Like 1 (SH3GL1))

Alternative Name: SH3GL1

Background: SH3GL1 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Molecular Weight: 41 kDa (MW of target protein)