OSGEP antibody (N-Term)

Catalog No. ABIN632411

The Rabbit Polyclonal anti-OSGEP antibody has been validated for WB. It is suitable to detect OSGEP in samples from Human, Mouse and Rat.

Quick Overview for OSGEP antibody (N-Term) (ABIN632411)

Target: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OSGEP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OSGEP Antibody

Binding Specificity: N-Term

Specificity: OSGEP antibody was raised against the N terminal of OSGEP

Purification: Affinity purified

Immunogen: OSGEP antibody was raised using the N terminal of OSGEP corresponding to a region with amino acids PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OSGEP Blocking Peptide, (ABIN5615149), is also available for use as a blocking control in assays to test for specificity of this OSGEP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSGEP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OSGEP

Target: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Alternative Name: OSGEP

Background: O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.

Molecular Weight: 36 kDa (MW of target protein)