SH3BGRL antibody (Middle Region)

Catalog No. ABIN632421

This anti-SH3BGRL antibody is a Rabbit Polyclonal antibody detecting SH3BGRL in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SH3BGRL antibody (Middle Region) (ABIN632421)

Target: SH3BGRL (SH3 Domain Binding Glutamic Acid-Rich Protein Like (SH3BGRL))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH3BGRL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SH3BGRL Antibody

Binding Specificity: Middle Region

Specificity: SH3 BGRL antibody was raised against the middle region of SH3 GRL

Purification: Affinity purified

Immunogen: SH3 BGRL antibody was raised using the middle region of SH3 GRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH3BGRL Blocking Peptide, (ABIN5616122), is also available for use as a blocking control in assays to test for specificity of this SH3BGRL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 GRL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH3BGRL

Target: SH3BGRL (SH3 Domain Binding Glutamic Acid-Rich Protein Like (SH3BGRL))

Alternative Name: SH3BGRL

Background: SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.

Molecular Weight: 13 kDa (MW of target protein)