KLHL7 antibody

Catalog No. ABIN632426

The Rabbit Polyclonal anti-KLHL7 antibody has been validated for WB. It is suitable to detect KLHL7 in samples from Human, Mouse and Rat.

Quick Overview for KLHL7 antibody (ABIN632426)

Target: KLHL7 (Kelch-Like 7 (KLHL7))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHL7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KLHL7 Antibody

Purification: Affinity purified

Immunogen: KLHL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHL7 Blocking Peptide, (ABIN936983), is also available for use as a blocking control in assays to test for specificity of this KLHL7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHL7

Target: KLHL7 (Kelch-Like 7 (KLHL7))

Alternative Name: KLHL7

Background: Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown.

Molecular Weight: 62 kDa (MW of target protein)