GLRX5 antibody (Middle Region)

Catalog No. ABIN632427

This anti-GLRX5 antibody is a Rabbit Polyclonal antibody detecting GLRX5 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for GLRX5 antibody (Middle Region) (ABIN632427)

Target: GLRX5 (Glutaredoxin 5 (GLRX5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLRX5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GLRX5 Antibody

Binding Specificity: Middle Region

Specificity: GLRX5 antibody was raised against the middle region of GLRX5

Purification: Affinity purified

Immunogen: GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLRX5 Blocking Peptide, (ABIN5613787), is also available for use as a blocking control in assays to test for specificity of this GLRX5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLRX5

Target: GLRX5 (Glutaredoxin 5 (GLRX5))

Alternative Name: GLRX5

Background: Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis