PDP2 antibody (Middle Region)

Catalog No. ABIN632428

Product Details anti-PDP2 Antibody

Target: PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDP2 antibody was raised against the middle region of PDP2

Purification: Affinity purified

Immunogen: PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDP2 Blocking Peptide, catalog no. 33R-1790, is also available for use as a blocking control in assays to test for specificity of this PDP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDP2

Target: PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))

Alternative Name: PDP2 (PDP2 Products)

Synonyms: PDP2 antibody, DKFZp459I1928 antibody, 4833426J09Rik antibody, Gm1705 antibody, mKIAA1348 antibody, PPM2C2 antibody, pyruvate dehyrogenase phosphatase catalytic subunit 2 antibody, PDP2 antibody, pdp2 antibody, Pdp2 antibody

Background: PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

Molecular Weight: 60 kDa (MW of target protein)